PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SMil_00007304-RA_Salv
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Mentheae; Salvia
Family TALE
Protein Properties Length: 383aa    MW: 43084 Da    PI: 6.6154
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SMil_00007304-RA_SalvgenomeNDCTCMView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox23.68.6e-083293622154
                            HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
               Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                            k +yp++e++++L +++gL+ +q+ +WF N+R +
  SMil_00007304-RA_Salv 329 KWPYPTEEDKARLVQETGLQLKQINNWFINQRKR 362
                            469*****************************87 PP

2ELK29.12.3e-10283304122
                    ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                            ELKh+L+++Y+++++++++E++
  SMil_00007304-RA_Salv 283 ELKHELKNGYKEKIVDIREEIL 304
                            9*******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012554.4E-20116160IPR005540KNOX1
PfamPF037903.1E-18118159IPR005540KNOX1
SMARTSM012564.8E-28169224IPR005541KNOX2
PfamPF037913.9E-20174223IPR005541KNOX2
PfamPF037892.0E-6283304IPR005539ELK domain
SMARTSM011887.4E-4283304IPR005539ELK domain
PROSITE profilePS512139.69283303IPR005539ELK domain
PROSITE profilePS5007111.726303366IPR001356Homeobox domain
SMARTSM003892.9E-11305370IPR001356Homeobox domain
SuperFamilySSF466892.22E-16305371IPR009057Homeodomain-like
CDDcd000861.08E-11306367No hitNo description
Gene3DG3DSA:1.10.10.601.5E-25310368IPR009057Homeodomain-like
PfamPF059201.0E-17323362IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009416Biological Processresponse to light stimulus
GO:0009722Biological Processdetection of cytokinin stimulus
GO:0071345Biological Processcellular response to cytokine stimulus
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 383 aa     Download sequence    Send to blast
MALQHFGDDH LPDNSSVLRN ILPDGKPTDH HQRPPTWLNS AILRQPNHAN FLNLHTNSGS  60
SSPASNNQWL SRSILQRNNN VSEVSGDSMM ESAAAEYNNS SRSESGVEGV VNWQNGRYKA  120
EILSHPLYEQ LLSAHVACLR IATPVDQLPR IDAQLAQSQQ VVHKYSALGH ANLADDKELD  180
QFMTHYVLLL CSFKDQLQQH VRVHAMEAVM ACWEIEQSLQ SLTGVSPGEG TGATMSDDED  240
EQVDSDANCL FEGSLDGSDS MGGFGPLIPT ETERSLMERV RQELKHELKN GYKEKIVDIR  300
EEILRKRRAG KLPGDTTSVL KAWWQSHSKW PYPTEEDKAR LVQETGLQLK QINNWFINQR  360
KRNWHSNASS SSSSTALKSK RKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006345637.10.0PREDICTED: homeobox protein knotted-1-like 3
SwissprotP480000.0KNAT3_ARATH; Homeobox protein knotted-1-like 3
TrEMBLM1B9S20.0M1B9S2_SOLTU; Uncharacterized protein
TrEMBLM1B9S30.0M1B9S3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000403510.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14322472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G25220.20.0KNOTTED1-like homeobox gene 3